lighttpd-1.4.55-bp151.4.6.1<>,@^]!M@eee\Q1 `J\H,^DMR,78P'2`wQ^Ӛx8.g1m">Ğj'9;wԻ3_CF]VAh]PU WgP^s# Ie6쫲JkgJJ&lDl{gJҰ~ Zʬy9>>I?d   V&3 Lp GLj@j j j j .j /,j0j2j55j7L7'8(';$'(;u8;|%9<%:?;%=>?@FGjHҼjIdjXY\ j]j^@bݸc^de flu$jv,wjxTjyz3<DJClighttpd1.4.55bp151.4.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^]obs-arm-9/aSUSE Linux Enterprise 15openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxaarch64/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O`P;hp0pX$@H`p z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^M^N^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^L^N^[^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^M^M^M^M^M^M^M^Mf45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456d1d32a9c618675b090ef53238f472c4ae0edc350248e009e9113eb73915d1320e6529ebf10fb5dc6e291622bc964ff28a383d996b18f632d7f06b05d0f0e4b9886e6eebcb89660a2d9391c3cb8dd32e3fc8a08b11e2f9486d79451d5e334db8a632132979f8f1f1a084379041b9ae7cc3c6b40b3302220b6928d34f3c637537f2dd672906f205ee015ff37f641fa52488b3df4638e9a37ddc162142a3d0c0b49618c6e9de524cc32cd46a233c5ef9b272cf45c750b9e243a4eea06f2322e997eaf4757cd2f3f3e348fd21c993954af3162d39122787ced484a15b78873c27b6aebd577e64603a1cd788068a169546abcc3f93829b56c12d8095d935adbb59fe03ba9861f15a26186b13359cd074e335b4cc3c37f26a6e61f2b13e05d622ccdc057afb12872ae49f7a3eee565153a3b6e5e4492d55fa8cc1b061bd8bef04fc2470a71ce90a384ff0da5eaa4e3b39996ca242a8f4344428d252944b4b260a0e357f0ef27465318054ea2efa2c3b77beab9ce2068885681bdfed86cd72c737b49724682e11886fa676144e330c3c583ad2b656f5366192c78e9dfbc3309bb4f20b9daa9cadf3d64671b85128c3978b04a78000c635f3f50f8181359577ad3fed147fe05cc762205e287cb903e256d7c1dd58f308455bc3063925c52d16ea389780c1592ac99cc1e3d84dea81b5a4a3575a95d6c9ba6377adf6dc88665f086a5fe447ffabdf44a1e4f6b60b9a761e42cedf37e8dc72250238d1e77513345e7da4f3a7e216fad684215a9716e6fc7cf2083d1d8070bed51d72a1d4e5b8cc56e570c2dc969f97919ecbaf2702d3e5ec2be94031d739d2fa3ea1c96b4bd8202aa6e7110f335c272792055f146a14ee06e1b26b1e52c5486f9a0c498e652c728acff181c98022864577476a437d1be218586cedc1bec1efc537098c9b7f898ff7973ec7fa4ba78963227d7e14fa1e8b28e1938e1d5043e5e877bdc1ded5b92a8b97cdaaa7d6aa5e0f6105a8e179b12a2dccd572abecaebc8106ea9f8c417fb853090a1513cdb148e414a6450b1e1424363a88ceeb9603b097fd6c1b9821f40ed28fec8a2656ff2799781c6cf22ad86daf9f4d5b08e390d659c0c4f6131400cbb12d6d51bb64622ea82411a13bfcfbe6f72e288ede97fcfbd3244c68b6bbd346c901212a5097b39867f2f369f3417b10085ee80fb215af2ab50862749ab7c88b12390f50b033db03b3f862eb5959386293323ab97018d507513f02c1e1edc7cb7b09ebdeaea774388fc7ec5bb83eeef7f7c2a9e4b0d65371e75bf4fe2153b4ca55e9e62cf2749013a83225c6f930f210a057d3306b8cbd892a1578c828217b3c1ba214aab9098e728e72ce11825f515c971881ee436fac7c7bdaf6215735c874c28b42d1c2af2bae5e7248c96bd9abb2462477355956c75651ceb7a65e8adaab3c554b55daa670f2ecdf39472dda4327f3a10fda7bb1eb9892b442b92ad8ea730266389901a1b8d156c2616728834a502ba0d494c3236d3bd4968f39e48a24f4f577e880e5c77a28af568c6bc297e08a573d71b8f59d5154085ff3193f9ff6553f5653a427762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-bp151.4.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(aarch-64) @@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgrepld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.17)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-bp151.4.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shobs-arm-9 1585644637  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-bp151.4.6.11.4.55-bp151.4.6.11.4.55-bp151.4.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protectionobs://build.opensuse.org/openSUSE:Maintenance:12219/openSUSE_Backports_SLE-15-SP1_Update/ce75ac59626a8db83bbf99ea019e86c1-lighttpd.openSUSE_Backports_SLE-15-SP1_Updatedrpmxz5aarch64-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=58eb7fabae265fa9e5c26bd651fd08e93034303d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7064bb4d40ff4ecd6b36b44359d83837a435bee2, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4fa711570e071b8edcf2e88f4f5b1b9264245abe, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=87972136a320d79c775bf641367881a40d959604, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8283a14fb7e980b3d5efc6e238c2189cc7efd488, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=af4bf71fe303c0db3f67b3b39b195f1c261434db, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=393050cd2983c2390d3f3a3cce9d2bc2ee2cd94c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b5c45d5f8ac2d4c20b2bfebe23f0d8582b389bb3, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b7a2f4fa204ba62f226693dfd1c377c0eac08b1e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=90a1d2b20d2e802786ca5f8ad023e90126c2e563, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3adec80f312e0ad725a87cdd24253008ceeb5185, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=016871bd29cc2ea3b5c9915728a74697bc999229, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=08eeb5c64ee9b9688d8286b0ff5511c9d96b5712, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3fb10bea1189c38740a9cb6427e72008867161b6, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12f2adef799a7c714fc5f71d8e3026c73cb28866, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4d1aa978af93ce681b52ab73e3bdca46e46e5eb3, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=910899881a201420ccb70d20199f8ca79a2404fc, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=026aeed71c6e84ccbda5de79f7e60b11c3adf9d5, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0d4ee24a681dbfdb544622e4c8f65c7c4c89b13e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=751aa66da37950917be77906269039c67b883d64, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c9a0fd73f20136ff399b856053b8d4eea18b2070, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=69e134094d833c245778f55b8052695d63f21d01, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=eff185d8dacf78e48560821b42ef5172a683009b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b6d609217883ef744bdfec64e0eebe6c95a419e9, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9c35a495b67ffd3141a2872d561bec61ccef2107, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=71cd267fdb3fb36e83577451c53d91ba621e73fd, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f111f8ed0812e81eb1cf4c5ffa5e4d11bd336452, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f4e1b5e593266a6a87120ae70330573565e0bbc0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5e10b03b74319f33e169de88e5bb45496c62ede0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f2f53f0b1bc0dd96becbc856d9bf50edf738e04d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3bc5abb85be2cf9885e5fd4abfac36020f3f2801, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=301fb30a3c1ff591141055d3936ad533b096076c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9bfca6bcba4dd1c9432e68b323b1283f095f849a, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, BuildID[sha1]=7156755f6976617d72faa86f6aaaa41de1a21a69, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, BuildID[sha1]=c9805ce68f3a0c9577d5c77e7ad27b46673b6446, for GNU/Linux 3.7.0, not strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) "')+-1579AEGIKQSUW[]aceikqRRRRRRRRR RRR RR RRRRRR RRR RRR RR R RRR RR R RRRR RRRRRRR RRR R RRR RRRRR RRRRRRR R RRR RRRRRRRRR RRR RRRRRRR RRR RRR RRR RRRRR RRR RRRRR RRR R R RRRRRRR RRRRR RRB5&Qlighttpd-mod_openssllogrotate1.4.55utf-814ec01bd159ea9ae3edfcf3cef4b688ab7ccb92977e72383436a72bdda15f560?p7zXZ !t/#]"k%{U}g桙Ⲹ9+ځm#%T3c#NÆd@ǀ}O`C2Ydh`UDct4o?`~yg*,9NFqjuv䞼o[8?Y->0pք;vv0-7 {Gz.a)mPy+[gXi:ɷߓLH(5VndHEKN=FW1HVwVWesN~&ATLu7AڎD{[\M![Q`H~VWJ{=eOTsؑm;BT*LW啦cU-fi FO[ *:4&meD` B-7ԩ p8em1{pwG9Zrl Ts#< Euɇ*9k?n>0F,wnN::'9uvC-dh8U;îz?z2{ZeI:>Ya+E_QQYݚxT1/:1, !ār~>2~m*Bn2URFts(G^Ip@K=kaGH9=^"i_ HFXwk8$]$,0֙Yd߭yj3կ‹Q߽9O%<6ȡBU8s  ŋ6O`45-3F9`H Ȼ@sqMSic(&\]h" dy'Gyc6B*#>g&qD=)IJ[ź!4u"6]W)'Co2)9WW[i+9#n"BhL}SwO»|zY^].:I&G,ͅF fPY;ٵ52=Sau\5 ~iʈ_!C>ZdЛ*]Zw?CklFw2f!6+E'm!>)%?nMTG%P7LMtyΈ@uM- #O-)$]4>J!KiH- fF{KYS\5g[I|"V-o:Y;dpQev#$ZZO9O֧fi,)uJqBx (Ւd-yw*wcp̆TWP^q]n l7; J<ݡOt" n0řY+*^#>nfK_9աDߟ(턔O#:aGHm&,'X¿##d>bwڡr_S#2 FUϼ ﹣s\̀W9ѕEȓYWu=l =JDR mu$ 8'0(K+ߖk5:!ϙ5;HR$-ǵ~Pnp8nPCWWA#$}7)LUrxfMF_^'q"A#x-Oq wD`ғ6gC.N؉^2:-սL]o^0-2!B/a+Vy|\&LG\"ukˉ}OV\7,Aܿ|`xy'>e~Tƶ1V?eEL5-c"1޹A-/n͚^3~:$7rє*w1cZ ga"+q7hB- Lo<\YQdDZ-xlMtٲ8첆`]pUgT@Oű>LMSǶJЊhJrh)P)zXڏ ˩N2D`*.dHݺ;XMdl!T䟹V8ȩRɗ5ߡB0BCЙYaQv e0[3p$#3KTI!cKB=tΕf}e,I6 y᭙Z-Fh|ȽqGZ~QS s;F g$Xܴ=#kh5 eU_X ( ~^ӓ%Ԝ/5j}$hي WUX])nqǷYR{UdݬoаDoSW{fRz1Zٹ,j*N)?F}l@ Rsdr *Xc.cLp˳ '\_pz#VWo`WDlđG$>e!uBg DYzL3>F5΋'h@c|O($.Pdk ϧ.B&Xf雟&JʅIx6]8]dP3C4yf9q.7,{mD̗>]PfƃСߕZ'dz_*)&mc"<~B#Ȣamrfa;1wYAneј#\*SYWz/Q]ྒx.P)XQ31l.[.t7i a.ߔ}>Ra!bq->(׿^L\`I 489(>5QRF6KQ7 ؉Tw9+$v9; ߣZ} #?وbTEi[XO7'e B HwE֋AݾFo!mdA?VLr|gTV`"}[|W/:o󞕫o$'c,ݣ,Sg"TSǺI@icը̌0"dً잇ҬQoj"vL#M: H- K7]bR~>&NGQ/$R!? ƶv]k#7f0LOv N"GXO"*&OJ2~ ]S 5쥓4rKr8N)0RTmY.'HP]!]Κhum;L0T"hhq+s<$ɄS)SG^˕jiH]y\[~bq¹*)0BvM'iTDI͎6[XW4B̏8)G8.ssyd3߰2Gl2 b%ޔʟ^K #S!msVɂgq# nW]apYH}c-&^t n3‰R[520n}mݛl[U9@i}aw%5[vzit( S SpCUx{%짻(Lly2J3~^éHN-6n$ݞD9vð08  BN3RA {7UU9`vaT`HhF/ mh =Eo) "5PLݛWVS6 eM3>5wvjTUWVKnKT)E8?=yVU+4A$o=vC\u]9BFY#PTAV_.j;nVV*@7D(Og¹v.8cIl=*DA:W3=drG?Ck=jd2u-_~ZkbMNI5~`nݔf :\ ֠缧djX9,GtvNPjt"{P%Pk*|npVwl> .kT{`Q} H0❿ͩuUfؤ٧W.m8=fAҋ#T ֧楤Ț׳\s:puOaPi)bƄV:7zWs?K*b^hwT K8%%%_:/Vp5+E:C7A樝I*kW@ÊM wCqMqX8^g v! ㍿g|k,οr.i{cJtR'Seڱo&a*^}SG2(dJ7[bOcUxdZ1>K?uW(S(ꑇLaO( ao~:,iScqJu'Y]@8d>:e ~*k[G+`瑆Q^mǑ[|aapa,0uXVHj[O/%΢`c<3yχ>6tMo0nV-ĄΔKIb׎́Ѥ$K2-: "CAى{5򧃪 4y.­:6N=܊xdO|\^;ÅV*,wSd6HnE=KvY3 8ד=ϐT1׏^3#lmV@h]L^_6n8Pgq6b CLsLIy*۪ǹt&65 Il Y|@[By\Y\}RuoF,z+٦T( ш|ȼYM9iEop VtL*FMG(U o?XbG&yw)f{ ,/IՉ2I?[4Jn#nNoZ\Te@20W .Բ,e c c8WtBv 98" m) C3|;*οy*LO62]ʴJb'+ "cCć[ 'InYANxT悯`W=Y*"J7Dt YtfԠ) C&zïD7B&#(&o=}8술>>sS$&;P^QuL,`n^Tge b;"X|z3ګ4 tvI~:CMA2\]rjF[s*{w SKq* vıq`v?' W=C0cU`|d )q yYNdۘ@ORK קGk ]t?Me>򉼛t5usqlk}{xK_Vcn m*l4^L5ylmu8/"U#I.FsvQ17?sdOh*Ezm~,i.A/7\@2KΎ?"*+E隠,َ7X`,c)|~-YgՇZ]t| %t-C*n)mx!4`ӑjs[ce~طU4mtwKīo )w3`IO^mc`tN-SJ3L[ g  _8ߟ{O‰R9\+Kmo4:LWǚmpɜ*;!WsQrrLl=U>.q%WL) ;%y2xAό'ٽE{{@"*%=.HHdaN|fq|_gq Uku)#@)` 5,@Y\%'\}C+N/]ySU8)FOF{m-@ z<}J#QuX9@ebW6pƢ2Bp$0-}$|j&^Fa;Dqfwq*>P'\Hge/W=Aew+췩:ě-d+V6#L%n ",#;~ܽ>f6ɻN2QE~d L)4#J/$V>k1{/Cɰe^c3vNe{gma=`i/ N4ϦR"q{>~FCS>%lxwӼ*dYa[ w.}L8O ~xQD:cά#.u)?}>L{LpDRwŁRnCAƦ|4f+3| @g?p4_JҹQn%a! 0UN320q?t@L΄myS͊Hl]j{UFgoyr>d1-ēW'%sk[ ;2F0`qvnNB|WXk_WTI@.|wjʢb}L߳鶜S&:8v͍1%INл[ FסkZ!KК[`ӵT640k@Dz4>F`PJABv~;[C̬GsaGlKWk&?Q?qx|Cފ.ȰS x8FǂJ$Dbpy]Miv`B6d]`z+W0P'OIB%$p*CF6k|;qeqǗxe/\+g{(>jl=-BikMi`V5g"h<Ԅ"yV­-!k@P"R Gae{yyUK̉{ ~_e ]"#MP/qyKm[%y Xoms'6] CU8JkI?zA 2k֢Y{wԺ?%O.e{eP keIΤp46wC6,ΏciK:0Az!&ZٜWڻѾ0AQo ?t؎Ȃix`-M)5Վ}daT!o?"MwѦF%JΥ^'Z? N9#z P G/@#$0񢆴kj ʟU<nVЗUe슟<_mHK^2Y.Fy{pj4b&35{x?VahkP=l6չf)u_+Ɲ*nW˜﷈K)L Ǩ;Ճw0 X^B͟>}P%5Dcٍ5lbMu(N!/E``Dj$Azm>0]+-4Ͷ5OtIX, &z•'gAvKrsBog/zдq%-u'AXj4:No.ZS'1 2:o4 v8-q=f$hqsVHe[u$Lj14?M?T/բܔ$/1bf*gk_TWz| r>1+AvCf?AYqxSDm'2t'vl$Y[` 2E| Q=<KIe!wBO!!_qUֿph[Ueu; 9kV; sImPL6Y[wVu!ctZU,o2u3 &ƧM^^b2tD۩M5C/3,E@Zi8o`C3XM;#h-^}]$D,#$D~ҁ抄#8i`ݶðe<8gsp0B zz7 {/HO.ˮ<>E零ղV7*Y "=VƌyJwb WL`_HTU+v_G~n^O'/m늨F`Q~2V3ĜsX Z= uffZ 0 @J 28MF-zi@GnJy]3tF G{Ze;*ɤaC+*BYz*_t$?2p@vM7_C 4^[41t/i}|w}=/2S$;Arvk,C$ ӫXU3 =ZBgr̯Ve\ I즵_U2WT]G2ZuD# dyGyAV%oVrA][( }6|=rhm=)7)l?Xp(9Y< }^Ŏ~qK)C1<{:;kRJ?!Qնd֣OyFWTۃ/t Ib1K,r yӛ*JI}_;6~2͚ u! IM3Gt!O0ayq0"x+;wTxӘRP9B^/8J;4ꔭtaD]BC62i\eҮ}1o(ρ$Dƍv0^ɞKcV%_`ʵx`vhW|>[Љ|2?v"G+ : 7bW# 7$h0Ⱦ=U8M\٤/rrvm"¾}6L/?hGQiGeJ'ҊYo&8+"`"vaZj6W20q+bP2ظƲחUS1/gQ i.׋薲W`P%y򑓼fK[C6jZ6eυK5'Nr 0CiEp7jNJJhTdycbx?FI]_Ūs2*z -0BN Ew,ِw^3!,a`HI kP8.#qսb1_pծZ/ Ko}cD//kYآ|B0NO1w 9^g4#̟ Ip#4W9z*r -,Quh$J p+]Fxq;; H!43buh< ֟q C΂å4vg?KPVp{hc@iZ9,E Q۫Z#c45f'LP dIדfNوDט:xNXdnςkD Z#Y:̲:L&Xuy k7Rk*EVKԽcԎKg) pW[p=hN~g.&Z1IdwqrzOxȚIWENxsHQ KIw*lTmȾ縸jY$l"PK귤iW˝mW~,o♫xܑyXywE꼉ċt3pӜnF-TQ@=iebTFDӻli,Tq4kF<'gEu&)]7-!V"de)/V"p-]k*{{fCz5YK9 6 _2 { UlW ኞ'K6`87k;gd\J0 &TJwiḤ+A,T|#sSgLS 93(ѫzÀkL[ 3󾳃عpp#NY!K̀𷪼qQ :ˆzsmO;Wg 3x縨\*"<, bQf?`6 =~te&)ȃ499[ BccRB+4?Џ Y[]4MK1`ӝUE]D`֟@>{ Rd \AWѧ}[j-c̻Ia{e:Nnulk_t>+dgKKƿ$J'9qЫP*$+j<{i!vN 0|Algbc-95&UR٩Ru]j=-~y`ٶRZ'MI'-xέS"aw=2˜2Sȵ& ?MEJ[lp+ÂzgqIΛHƫuٴ$}@  yLPY}t-ytZQ ?o(}KEsH/ ǚX9Qi^>z)}IjmdTj|.[ J6<9XTǑP_^:?> \se 9^׼}_S䡲S܃] 4M?۔sj(]>zS۷Q4~_Y1A* iSX$[1|NpC̿ૈ3Bgn_YcQ0.XiԮ2-O݁[4wF19ږ/Mzh};Lv.UN] %P:~"t~f^ܐF]Xm43ZXȷm*WJfTK?$Nv>~? :k N=ӄIz-n*GSu|X!KXÍQ H5KE-^':W j*mu-0, x>4!/t nhȵ9U9x-7eu&|q2Oj:K-vnE^T,(Gϕglہh\!K&]7~,g%aPK5d} 5^='Rw.^:R7FU~rfPo1SmTWb<[ȈFA`Vyw{׆8T/}~Uۆ9E~XYIy^Poa0 }z&+/OV>_5*|YNT+n_ @"kcgrVT);Q9.BI݈^ ubInMl&o`\1С3\ˏ !ɒCw{iP]fFRln$B8> 勷=Ykx򑣼,[7~x"P5P p+Gvus!l] H7+>c:>=ڒ%+_n͢ר_t~Ucn3Ӹ0Fe$zqI.3d~j5bYK:DN׮ F/teei<>z<Є^켤s/L,kO5H $ffP3'z$bȠY25^K&@|b 1>OS6&#mu]n'ѳe#3v%/8bLge-Wӌ;pM`>WȤã@qR@MYT]\KWșA >ڨbT[bG)ݔ;:LMC'Cp+g^ "~J[J]l3r5# {4Ki*H4x>y5p]Lq1ojsC9TEVQv$4H9pٜ"0΄bc} YQs;;Ƭ ˛)sqYE_:JC57qFV{IHnFVrS铏{ҤP/HYgP{+ |Fe8zz::w^vq$ݻ\jDy%cyy9.cD}TꝦ @~ҴaTIM_ ,OS@r~JQ>県n {O=uKվV.sݡ skZc= |K]qjkqf o``ح>јg{YG|M}6nڊ`LL~/cr|>` wk !)3)/)#GV5KȅH;X=Cl$^|O#uXsșr r&!#dR,@)K3)W*g$NNdzӋF#6mt# y*Ѥf'uľ0g x#f-2_ kcRղ쁅&KhDCSeCzK[뽱z݋=7:p%jJ*>%@/#~^umi>=g֨SU=yS, 25A!^9 `"3F\wi\Va1։mNuvh~Boqz'<~ÐAr|gaQb^YdI|D;V EACgVّ w_Sbs hC%, @aZ@8- : d^@t(& s<ɫЧe_bٌ|.Z- y%ӱ N۬f\?0b,b daF^֧_k##mԋBht2LG=ڍ/x;Rz>An Y [MV7 $s ~wH juK,,@p4 ab1Ί.B-$ZN, 3H'`*J*Wqﳕ!.?$]9hWmk].ˣ,,J"6$)|dyG'CPǦըy<2 WKC>tHMz}y&imppl] V~ǒ7!Io\ny}+vn̹o~..k74VY4!h9 עѵߩK6ϕ{+xY71ZSFcӏFw#_0eUٺQ%g5|:VEJ)O\~>c<= >:Z#$ƤqxXq V9jG in lߋ NArz~;+9$i4EѺunWWph 'ڮ_?qvQHMI4TA*+ []Q 6pG>2앰pQ04fHO%}kXxeR oyqj/"uĬpBis~JO{jYI+gqg{B D֎r5طT"59yrO8JaőaD{} ^vϿUԃ_anSrH}Gk ə(:)^̈́Wk' dc`.ٲ>!,K:`R~ 8Jdu2۟%Q7d}Z+ [S.ښI&3{.{!;Pi%"~n"oc1OZd5#{2+:ȃR[],櫅]=wI&w6V4ȣMʌ?/ae ߋyfR"v6Ss VMlQtLvI4 _+T$1Pyem$|'z3r(%MȨʆ\E_P2/!XaǶN^ҹH6҈6i~{ KZ|Tu=0wz13޲ ˴]8)}ӚPk$̯ S3ϑ `NI>9;/ocjجK]w>K`I?[ *t?g D:rYw֗PdZ# {oP < (h2vQA ݙU`Z>qׁXq( yj#HF~g LG1U|B" إhvݍ>R. wS}^Rhdg]-;'MzюP+edj1;asqݟmo6>*T z]r޴ 35:db}q#t8.MmajE&uwf42K+50 kk]mc.(=cPZMZ )4-y:jz?j6G`3Z/ffrI6Z"i|ʿ1,8 ^Y=?4>N񎪘mTFP,JPTJ[+ػwiSAɖ"i,j#/RK F Q+-d%]E0} W~Ɛ ʸz=Q>'U. 9ŴЋϐpaE%13**d Ce*P x{> #Nq{mH*~w3.T6a/* vːKS.)״nq:|qh=5K"˄ګ"S7[n"Ab|wjq٘gZ5%p1ZNHb =+rN C|9Py6D+b+hCkKmrM ;`˝S2([;kb6V-plqLk9˯rGUBפSv[-w wtyWwr\ $lV3eռ*_ 4r&?|Jkz#(tmҼ8Ӻ<_<`69cvlYՌgxէ_u&9!boy"/tÁAٟych a 9gʦGѰc0soŰK G$XgRqNF: _F1P~Z}En}cݘGux+;ӓ73X|䌶32܍%Ɇז^VF p+ihB~ }xxk(e~01 ׻V,RXp7/]hDu3*{2{ăfB$nRhyܻPT -?1N~ H1E~G?44 Rgz<˂܉Ss߹(yHvu9.z] -۩w]$XhSijB-HхJ.?tѷu\u=⮯V^48z '*:0/o@a#*ٚWw@L/jhloR@7o6\Jsp2 [9z x9睊d̈́W! -Ka<EqXmGMN~Z?!M P:1)3i q\3zP8~`8X#T 'e. Գ/DdIJɄpDC=pXѣ/R-N<ΚD.W:gGA` %}p]9PHvGLaN .PxȢ1K"ww^N>܊u@MjoXq"ᆤp [gU8P4]{kRg.Z)v]w V!x/~[9㗈zuK0yvfGm0֝RDqҮ8/v].]+\h)(9v'bjSEKr]0JU~r^o!8>]Lvu+~ráD `k;V|OiWēǨXY`b q  'jZ6bUN>N5rǥ7s_+Ks*@0,GF%]^r8`E&D6+t`+mciezjgL3MNvZ㱼mwx1r,dE 4F+02 uK? k,y > cXdِO1ĜF:߬}GEY}2uc\{|X?{ӈ$v1xKlZZ):{QZdX}}JtJw [2'>O3틑wmh}7x7Z3&f&EywD𥸻`ӎkcPmO;*\W^7Oq&`W^jp|]UgDyAw?>nKPeAsc+W5ma29CӒx D[#qS$j`5ySpJzGU!^_5 1W{u?[˹RRT+seH߳׫tW"sՏir-ֆWW|id.Rt\БW}@o!nuAd~ *13U8ctH-)eOΉ@1zIz;@gcC!WUZT WQa NUy NOjÞ,FJ0$"gj `Χ>`Eww~ʕaܳ:G9mQ)H-xYKN kۛda6[`%B Q1i֯Kȗb=2dl1( + eI"]W;yn#2H32|1Zb󛙇nqŰ@D!7/%u`Z$Sr i_ r (+6Z5"DW ĭ* Ѹ)^J`AG#'*S(*hVtr+UO%2'm7Pw<;,v[:tS$LPPx s/J-nJaxOiU;@PO)C ž8VUM9. 6!F+᫞;,XZqTlbr݃`"ג }^A $;JU[N[Ai-ޤ?q+ZĴ/ F@$(6ÐH%FaSQެCQ@QGk< uHѻ HLkURt+gH;JcL!@V].l6f Gh C5Y4# @ rܷdz+{KTl'iwvTFh1zRfa#T^j6Z͘Oyі+H]E!؇?vh=ր-01{ S7(5MVT=cSzxήN8DN.jc7M~ &$n'1tߝiO ;Y)YG/TDS[JsՈ+]cRZ΋` 1Ln\Ս|D7l#EHxv5^i.]wG\O=#dz^gP, q}U,]\GU-Hh; A_>KhX@ yUΜ&_mK ,T̈4?ȔB7ܝpo_BqPBdG]2P-ͦu(e-QˬaeXҮ5'5\R"vߜ+j҄ߣyVY>MfT:6/c*`oWb -+X-q թ܄氮kxY^h\@[DDQ *GsAfKv# /ޤY!X nvC "uz\ijѢ^QA3*ͱ̛$3PltHdT9cx$a& Zɱ@Hbl!hOyyFjrSd5<FӥF\ ]8 fCBF_EcٴIeA~P.CUXxjNK[zyWpghoxqӿޗ ;ԓ=訍~H7{?3ޑo 'Fv^$GVe:g7q|B])G>IkK֪ 7x 4.m6@PoYn_,Mp L'ߧGS~֥i4?&.2<ןHzP*=F'o6t/ 4a)ieRZB;J˅f&,?[a>R `7ݹW2}eb{=np"ʷ.#JL@]k;Hc1+J}Zud>r81*ԍRdDطѴ?BTQ)X+<ͽ8y=jU0Gݼ5 ? L 3 w;bzS׭w6 >ZzxD=c-bZL7cK|p2=+oAUlQfT ^wKKЀ `%b`uz}rilJ;%,pF*Ҷ.`pCJrc6d_#!~hk`v@bԡ=ʕX|lmit\Uw> [`gCq k:4|7v *[▨9Mzָ߯-ٯNeҊ&O}Gγ}f*Fv;ix0L\'C-(S/|ai;=?pFbDweG53!W}t,Gz2ayiwrG 1t.,~Qa~T6[/~\ l4ȣ0LZqZ5h:( nfk)ep%Nƈ5j+j6 $+c(CAVlBxp81WX;ߟkvgQV#b?F: ֋|8P v~b8p d5\xzBMa5# "eG#C9Jmt*ڲ˥Bڣ\+wW\.4 LLR0 ioWV(Шz$QaWhㆴ"J6j`<wTWBlap!5" IAw ,M* %NlcEd%U * Fw|sƳn?=i*Y}knM^ r]u)[~ z.$ꯔYXqSڀ P,.wOyb{ehB4OP^SsH3'Ʉwg1ӟd/qD^˖,'qZacQWeA{'9tft)V>wyBK 6|;kCmUĠST-2EhoͫO?,I>u',QАIL=!MȰw{}աIH7pyU]{wП/w*]?$\re>!(:R)Q-{c?Y %swHexk$^禁 5^DmdE>7ع76׊FBy?Wx}ޘ:$;r#Zi + o'V- LhT$)1 #٩Vwg28^JV<.%]^mB?߼ m~NfdP0F^:$j+v,@=q RJ0#T#Hso 0 2z,M /|aW7ԫUI!a0m|Z.AIm`' Þ⴫YY˷x! 2k4ޜ@0AJuGѮ` kv z3U4'hܑ0RAu:kйn#jc/T/sf/E%̐G%&"Q { c}?Mpx ܽD?*UJ lY2P =J.+} _V0w$; F$Y?'ܗRɉ{ .Tn\q[n6wO= W ,S {Sos:[ȊѣFOLJb#n3J-*^)hG6ku۔7ϚsKBs0*PQ 1ƹ\jWXv= d=Xy2Ğ̈́SQ8EœAw6ڬyUߛx"~,hɼHFG0tx?a1O'TpQ{fVG7.ݤ~%4JC`7Etp)uu[P? !=sۇCvdYDFvΗ|gӷ L* DyvG< !{ (),A?W=$ BCicKYBS&^Wj,..w/̳}PL|J \R&z;Sa~0gy9eư=ԤӴ0 ~U9L)@%t~Nē[F%Peu!h0biSONiw[0hœ R`6C")[<܅-ˠ-n|j9DOnZ,B^/ _+0*pP+n{CfWBkmJDvr߅eQTG!9[7g|2d[)POb.e>E@\;ͅzkdXŻ{KR@߆PG*ǎC>藗.hQK m.L2yVܙG0˥ೠC#_hQX^p_ES)[I_̊Yy9C`XV#ƅ8} m]r @΄…m&G(YCI^xio#3p`>XYÚ]L>$[8%+ߤr.~xqFLESw&"-H@iش~o{=82ܘֺNӲ1JvPS0QC9o(V>@֞ңf.Hkڼ6EMZ90hX&6bpīcLv۠s֡zE^++qZT o<#$p2d]G7ivxzfH50_E>b xnċo!HG8J@&XgBb8tFWoڊ3a%( 5^Vx5z^wt*Cd ]4;E@YqVӔ<ȱ`S~$#9znUd;~2orm&gAfчF%t9{|wPs-@(7%ZwJT(]&Ql cw'8. F+ G49V|> J߇GxJcKTkI[`psm¸\w -c+SW11%D^ FL#Uκh,hbJ$i1C46u^:R傛V8'j򀗀26T$jZ4FY%.F|@\qm#]iP%hMHC~{J8%Dȹ՗瘉Y #,<@ѥU|*Paxd*LP:=zBܩFl=R;G ; 0HVtǦ*è&.vG1W4/짾#*ڂc='sdOΦ3 Oϣ!W1p$ @:!7JL3xzR9;||B/Sl]NT9d)۰/اZ}6إrHyʍ+H .{ĭz6!uEXÁQ\u73iOVKVk ͕&*\m |`ٯM(Ǩ%iј^TMI77̬r ѵHt<}rm2VJ>¤h;en^'-Oy琨?Kb?G٩,Vd,#,*n!NJ)pCԓUqL!E!T8<{S(𧯱q읎 ̪eHʉ͗8A7H:}6̥ >gW_I'/Clw'-CkDKL1BETtuw'w0ZXOx]ǓT?I22l) ǯ3 VH1LߎFnpB==w y ѧ^8y_ew2#~3iZ$T%'Đ5]e|4 4sN"zz']es;6Jje_u'w:-cluɴD"!'lu O 4NQvu oHGPGpwB1" WWM'~x_EĸpCW#ͱgd)NpE~':C/]eU0풼$IL6A)-3LKb'1+x' ЋTYDQ=IfȚ7 <юCUu0"^'C" k"BA#.+c/Ė3ͱ#Gda5v+)@/ӂ̊ vKl0n)+[%^fȲ}e*$&hL' KB!NYYqz^]6-v;i&TC2@kSj|,!45ZycpJs(z)^@-YrŢøZs] !yais+,>>vtx `Mk4'@j><\0d)@{|sf4\x@}z %a"2.@_~VUMFIQB t7%B@Ud|hL}MޗGSx UkINE=lp%}l r]`J'ڹAO? nmYKFIa΢:PIU1Eel*(=n̉}g^ۓy3sɵmp N"el|I$mvMDl)VM u_Wș$*hV+ݡBۓQ*uq , 9,΅⍶7[} qz׬@uMM X-;1ۊyM N?;aUO'#/|U>omkTA g  1s>Sh4Ndl 7ݡbWyͭJ)EqrtClTV.j ߟ_w}iU#niʒ}EP'EK"5ZE0h5Q#Hݠ{Td Z8h\ 42[he@ f>I&>βX|E3St[pFVT".'i78VDe uC%ǫV:_V)@IRñ&7,50q;% E ^iܰÕȒaP+ % tVKUB5X?R3/Y哰>u @rs?׺B˭:@_4}2~Fh(eo`e$ ]Ѽ0(/ wOx}<Ўl:ּZ\v}}w]:'F ܁N=y:r4m w.7iy@[XPƱ~gJzr#*}yOGnLqjCcKgsz'~qwea*-OBvb- h!Xj[7݃$˿ \[A޳M@fǡ:~ʈs]ZjWl5P>H35 hBZW*WYV$+~-uzl}?pD[]dЭWvlIK8$\B;*(@*h6C17{頟A<̪5O4S/F| }&05g_t~?-T8o[b*֖饹))#<'Bc)i c\!мRh qxJGFߜH.UiSJr p@x먦! <ߢ[(&X2W'x@nw7P|`+Q(͐/W!;+> PfB;[8|ٕ.25߭ L)miLF}̀ Y,wK=ćjEd(coHȪ z%`'IdO~Q6L'ģА؋odEvd_g\J>cxZ'[# 1My3/ljԔ Tȡ otԳG_zeIc>zG6 *{}ƫJ4LM5<ʵA nV,c`I6U^P讉qAX9:(}OHh/"iJw鎙GT?RY%-.|%4] LHje@^^T' ]e+/@ZVo핍M|Gƫ˸T58J*XKPɿpM̼awV; Ј4 i gX}Q G7պؿXN?s ]9xh>^;c0IWԟ3Vݞ.q`=< T ;>+92f~XQ_E=EϠuADбKsYqNAv&W 6c+CƟ99da }Ϊ?V}.W`.(־KtHjVWG?W.nDv8D7H\AZ̩uf:PR67=y)A`7=)9,{!ܟbgq1 ~\ԬOQ&yջLvL*_4}o QHPŁe]t*lGs>`ZRa4x3tNho~L(̱ILJivV> gE'+t 0=bx -^uZO1+WRӘKtAU̪h p6@vbA׬KM R4a1űC}1UAN j}{xoY3ݾ+ޠDo>^ON0Z<,h%|˟ >nHD-b(hk Ì\̣>7$x`  >H&J/YXp({Zj>;Yo e^鋐)Nvlڮk2G /uevvO"(}E׍k8yҦAO?h@- Dvz L_^ #w W8K;V ޅ\Tzv:ˎdCToHB+C-Vn8Q<))z#Z FȀ8& NWsT=<{C"ׁ>f}`h/d#8S.@zrw֜.2lbi&M pKƞ@6}szn@Yd ]rJNy_*IGSo4|ט1nbQ?Idi*5ng2]̔R+ru㲒l9mos?[K3dUPܻ}0"{E_M(H l\ԛ[l0,Ϥ-j=ƕV1GI$WYPT8C닟\%WV l2e?V^p0{v ~sJS|KHq[]L{4|[&L"YUTJiHH&+챆 ݢHб(T.?\3{W1>+⩕YsV`ddSxeM@<>Whl ,$ Z!X"'.BI(&-H#b}l"kw\%)Z, ES-m!02!OqZ^u<{OH|2.' _^cԁnhB4++zͧ=dd*`y%mOyN%JpmфI6A,d=R*pP5AGIy:!,׃ij۸H1y`J: )9AicT!CjЅY_ss| yi"K*~lTg,#U-D]oi',0Cc\X3tÈ=:xOZ2jj釁Ֆ (ͬF. jyy+lk$cOEeq U:˸8lkWkJ1TOرv", Z 8DabQ #5.W,6Qs}ML1iꌄ8A>9uX 潨wy&% mgzU޼56=K(XOg~r?QƸ7N> C+omr7b֟i(8\ ߶]\/jaܢe?Kq R }]4`6{wC1sx3UF\QTIM΀JHo^B{`}O~6!+I2t_>ZT>.5hS]vsRk\ ]g>̯-aY<M/Ғ2Lziߺ!1| q'UBIb]KbXEe4[>.}h~YMĄ8YZt.hymfCz8V;^|b%SRuUS"5mf!~#((w)g@mKmxL3(Ӌ_'`28f??f\ Eo.>OǃbP||kPЅ܈\op6 `^2ɲ{6Nts aND⻏c*]bdI/0 Wht'[@!|͒OĨ!0>giq,c9\zshg]ǕB);? Sf衰'rҳ2`b'jNDur76gSX @pӬ1iKc3Fm/R i sɛRzw pd.gL E`<.@HzaLBPgsq LI->T!Wjzεj"3йg-tCO'A~ťa{1nC']6ۗ2'Z߰7Lz{lPk_f\(T Zіv' C{Ȃ-\P*2& IvJQɧ!UjmkWYց:4X Iطƞy<5q^0Dpp!ZWW yQy P?3lyificRX~^)5V- +2\Dp106#H#hZl.OM!O)~oU0͒Ssys&IsDNdC9jk ??ַK@>r {1B;}=Ty̍#Nnֽ ZqouVS|2(GLQʀm vڈL7gn'aʗU~osATWxr>ԾOx0)8Ci{ [T>0ܯ O|ݧQk磨MnvG [棔hI&n=F j)J'̺%e؇dD|'ׁv9L8Jm!kFw;XNoxo 2k{ߴ'\%nwhEC]p2S㾁O]@U(ox* l DE%%## 0z- $a1 ' oחlAiPvҕddS0q/:cXo OG4KA]Vs>F,:Gϴ'jܦ d&]j%`LA1igQZ:U$_ʛS}H}e޹ f 09V3vd۬(n&u׋"]MgF'lc b]u6zCHk]t_+X¿RBe5ϰ3V yT!Y^bYT=E S@"|ǦQ0:y U{Zo2/'p=jlPHWJ?I[#~Cw&2-Xi@}5,Uh= u p)@^ЬSdfa vfHww:|n8ξԾ39k ~aw ȿ;$#AGĊ[&uʉeF7Fvk*QJ1e!{2)JBfW~NoVdI@M) fZbcԫW| ¬_t>i*2mV&kwmb(UFFM UK][n Va_qKl[4zS@YN'hBJ)=!gʰyMjC(BJGZhڹy{tx3 _\B/tC?ҠIm{w.mx66cF aV<ɗ0>/O*Xֲ&|$HA{M(Xu!H b j@.IR T\ɱwn>YAͧZiO|Nrz"*3&P#y`P A]N2 H;β?D9N+ :̠~)z:#>֜QW 6#|3-/=v L%l8j9D퐘QVK )-+챕ƴIE-peSQ*FAz' -^9-BnwSZߖM,U/;vo/{)0XDv/L)ގ?((UNULg enߟ$ix&*3Hz2,ev2\Pi$z?^h>oJV&JzQcCSCjv!)u: d6O:ɚ=LY`M]8 %V^?6ֺ-‰OGO60DGRвlJT}`悧^6]!%R|XVKPQ742ڵS?j{t]+vzɲj{&IzV-%¹o2o顳mKѬif@ Ǒx \Gǐ$: xҢ#j`ۯˉL(L, 4O,y^w}=IoT9m\E &3pcu>;7= Fhַe$ #Xd)gNƊ >k: Hq滱X ;OU()2dPVuxRE6DP1z)lQKYy=Kx d'zu֩t7N&FpiY}S^RZ=t]F@ iG~j#3Ɲ^ _;MwxF! k HB|N4F5_`Wo'V|aui?!Ljw3k'kR9!UqfŁ/;v^'>%,qozg";}F cOuKݻc\y.u}sW휪Cjjx 4Gi!ʶ6{/}q܂~TR KRpsNbaF~r؊P5w\.vBu WqTR4bBEv1*ܓ1g[kpuQCA?L_ T'3YLrw[^GA70f #"jx۲f H^~ [rx4aϏU^[Gf8N"8}ba1W}ؗQuaRQ }J\|`LGt]ymXs~2nv%"<_"Iq3jpFt*(q}NVܧVZ1S#cd[GaIeT(k GZu;)(&iѯH>>r\glz|a[q?#^P?ʕ]!EbhI3`E=* tp^-O%w:DQgԓeѡ}H~dXQp rr5qxAxˤNP5 bmɔaECeo$I/CfFCkGGl8;Vq}2΃v̶e&.65)΍dTY[?uފXUnf2MB:41HFCpЦT֨ &̻Q[&)jvV(j,V 5OV9AKvyʺ؆ _KeqKo}n5,[A{bIR`!Q`;2?g?P˳|m!*qCW]JG}sKaoA5CN.ΔSSp]+YiGM`}j"]xDꝁ ?W)_qAVYqi^r39D(5mc;XJs@g0'V)XGVS5؋ȑ<wop~xwG)hؠOSH_%Li~m `ӾLV& @}`zy2z53sÿsۉiq&ag2K{z1=8rd;[qX̍-3 _K\“A^8q^?i@f 4λ_L55I;|C rg6u&osY~lҋa)۾K!K95pNVR3 2]{YtS'6ۛp[T$n&Z ꤙ~Nxl H0/F.,*lȠBh):QO%P*kEL< 6uKg1Rx]j\'? (6`č]b޻Bo~HJݎkX2ڈC:|U1Cd5{״H=*O+@~QdG ȌQfه'ά(KSp>$FRMH%v/2# Neخ Á9J~mc i΁NҾlCuŸOq;·eՂYA7(9EMI9rBV{aZ$:: 3>0ȯ["p>>=Ce~H8|b)ҼW׮#5n?r @#U1~n643|-Vbu.C^Тɖg_]Y1g1c2N,~mK4Q7 K~dՇW[ gox엇wgf:`PH6jCE!1/f]P=oy4's훕;zyo`6%ҋ:nݴs(yHssLޑW̷{V/KV)=?v M"S˛5 PDed|#U`T)6rI,-VNV8sj5l'N.Aaoɍ6@/0"$){XlSUTA]& !BX=͢cs4vc96ug[es,L9cj01&ZUƛii!lkHbB4jՂ.bd{"9@U9\^][)&{i/5ufb<}7Ya,Q"[`|9Gu*~go$ܳsF HawqK}*aY1kgm>/(&ơיnk-oڟ1E8wĝ}"<;v?r pHuKDʌ=ѻ}=UEU U^$M)DOv~ ZƉ4oIoT}?CP7%]WgՖW'& 69}z+X݉cU U:C; )=݀HP 6 <<-[WKkjgɵE1M)P?1ګ˴ҫ< <~*O 5F)ԎfSח)3 CK!k+.Vcb* !]Ȳ#pV{BJ`%,aA4Jч"+n'I>Q/t@ewK%ށ}_@ rsJT+ԃ@i{^&\r^ҤZ_k񏿳RRTU)h3;J5b|% rp'HqFuXxcyؽַd݂e6C:XPu<ٱ"E+|]\+=v"sGbZ3"hZܭ5Le ڥy r#qmSeLΔ_g eD<0%ؚO}@I[h(%11E돈-1 ݥ5cb0{xc}9;ʲvā̽ Ɔ5*g(#u]ig)ޙ+iWú7h0[ZWj kmEsE0h< ΡdiÎXpۯ@:@F|ƧG>in`@S"22~#8$yqDڹHYg >P:+ fD%롰α 9V)1'ɤd5ŗPTn4G^SQdT(5 V%K@sIU 9BD;^3h iRk՞jÊ:(_it<=I5 ]inN]e @q_V. Z#S4J8 [ B52T?—%M I%GrAd9ەpMP&QJhi~Ӎ:O5˴YAHtmk6*ɲq;Pj-o1H?Z85𝓚 PУRsjO\G&qG41_mYoWhXR//k~N;HCͨn9; [U! >Q \%MJ<2 wXٜB/GM" GAIpфr_ z.dc8*9yҁ@߆S)?e~]&N9XOfҜ@gv8BFI3e{[ңQid )); Hr\y1 B'^T-57c㴵Wc"H* wJP=jM_W|1ފ:%olmp}=Ʒל*d*xW-گ:>DL \G^&z57Dt&}&w6O҂4If?^A4$-zfO:Mlv.UEA?SWsm#* !$E~x4WOJnK<*{F E^ǦQyq7빴ĵ3 | iQl}Ⱥ%gX?6⵿Vifr/j%=JgLFWԉ PiU_x5]toA4+ rÅnjEէ=.wjK<qeB?ٙܜ y1Fe^gD bE{PN2 тA]0bf+5ٙ;K?{sB*Fe_3yoβ7I-EQ,Es z:6gUI57/b"d!w$(X;&M|G9y`[|cCYN!$\9j.r7k_8=!h?>it]by Rp>2`QbL0VAV!1Ox?, ?*ޅ$o.ʣKwW᫂Z.tIcꈿZ46_wY]Fq]_<5q8o`>{c^~y!&cQdbTfL6ޓ Ķμ36/&ʺcёח~se"emr17%) (7㊟̰1^4<+8{=j* X=9iL%":Y'V!;e!} h@o: LLoѽdQi;Ԡ߫߹1s&ˌ_:!C#sk3bq M 1A͗|I~J=Yu WY-%:ٕT/yKQp{6WҎ.EH9 R Y"ŦY2RFSF`&pj2zUWb 4#j:/~g$0 #ՓfEÑ4]pwN>[*p aV &R[ay4'iE hM%c:W*@EYv:eJݔ?,d*rJL9@<5HPkqTM+,i:,Z,M>-nK46`گ_;6*ytꭋc4ip1"*P@ h>)""h(ό=wS^ZcDҬ|D 3• HWҰM̗NCVYRVCtc('9vCnR!>8v;r=Rf9_N 8TtN@)5ړ$k%+Mi/V؃~1xu53AIj?2o7#-O2m+s[~TѧXƤ+Auչvӭ/w:~{%8 j#Ǭa{ov~w̠ĨMbz{2.tpoV/V+-c=g>zx|¤+V+J飩GcK+;?*c[ XyПD"ױ`Ha8Õ|-93>ǃxT~$͹ӈv@6FvDQ'LZ{zL-Hj DrzuԧS=CP-Et=}V(+C1*3XVIntbM2;8e>m)jbhDҪepն~n}43^E;^^ =QTY l󑂽`'+M8pr[Q'a!/ -݋{of7(R&sn);<4^ uX<ȯto2*!NPPlL h9yDUD |-rZ 0WKggƦoތP7$,l»5؊ͦ jn߬y;eѮ;';UW_Dj0 sr%K*<$.Sd ML$hqyQG#: eh_u0x~ފ&t5vm _ %hUWbTpuF_}ʱl  P츒%X͐QI^΀TbQ[{bKF8NV{FyoBtQX/ ݛXEJI` |R2~B'FgR3ƪ#xG&'zs8u0S+"|أ*;2?K\NdaË_f!uV*SYJ=1*%9k?+I2sjX L#  #( ydTz! ܱH"0o=jBb2H .9Q᪥S8I9ζ{ǂ1[D9FR8Mw >_y+XJ~-g*'O\#8zO&m C?u a[ \ 1JדHg7{`WT>HTT3R [ 3 4YSAC!E_Ğ4hΥwKb4{-_)={pnQkDS>bG=L_8}RS_|ESwmY!٘LԫqT|*8{+a5h&wXؕ 4{t<ct:~Zѡ;yFUUVxq ,]zM n^imFLw&ٌU}B*qF Bc`$C\j'Y i@gN E#;|š`B%۔JDhtvP0RZZџ e U}ENϒl(ǠAtSnf7]ճқ <uJ*J).~7&{@ i[}(RO@v}!%FtH"scQ'o6b:|HBli#OVVRY9HhuJZI]7SPONl0m$s͊E#@wI~{ׅNlimOC5x35cxHV.cFC6;MwypPҘ~S2:R/`u%ޜ{A`.[B_r*` 5'lo{} lӭ%'eCpf?1{gi%ԓ^9 's7fӻ}T3ȹyY8M&bpk¦bP 63auaE9:!ȃh3Qʱ)Y~~Bp~t^ ߰=zEMN=PVNrN'"ҙD}zqȖeCG8VqЙ#Y7(gzUP|rfd3斓m@c gUtb'jή>D:RIȜʏY^{Y'*[񆱐LF -)+;]!rCB/U,Kll89<|^Q,.bajg fW/>AҚRG4HHAх'ɩ"rɪʏ)-F[`z<'"\95:QfH?B~; yFX?m5'oKSk"~{>|+˯a& Y BE~o+Xk @|ʾrt UwVdAHt#4I (DΠ&5Tq6j ø/ۚZk9X7RD(Rc"8 M,\!Ӧ8?]%N{ijss}A]KЖUlǹRہ"͕2`[ P(w0n?跉[B7{jW2"t%ddg888~#  EDӄ?5Hjz$N9sz?Z z~.sҳc oMOn R!']Q5RQʻy>D%9E8UȱO:W7Vĵn0P5B)lh w@1/Cq= )'ߡC#mDm-Fj]Uqp;2ՠeWB_ǧo PX q]qK[)\ ~csѢ*bQ]K*=`U oWPTr~8ePC}u6t9{ OYUD;I7RHw8$„MFq4ZH@ 3v\ vg/=%$*ۑmKPh&N\0$5sS{+P%,u:Ԡ 48h31x0 ⌼ZéO܆9O:cg;GɪHeQ<|ۅ('9U%iTyI 2pϊVu"Qj= P8P"Bs<*e9g~cΓuNwu¾grS8H S"FcJAL%_vSt6dn{`0KW"x`߫7y_EOߔq R 7=Gv߶z5XBo*K)%en-v3sgxa+ÈLnke g~ Z;Z3Xވ]f泒GT8V2Xo;$W4w%+MmX`߰)>Mt[,{7Skz6XaoM;o.nτ\V|RN[:^>V . /f9#X05SG8eR0Z13J^vH=/JbuDKцzy~y/F1#شȼh@ٕN8| MضF^ g{Uo,뉐f38?>щZhG2{{a6)HU,'1 4YAsV\LClUϣ<u1lTjQ_Um vhc_Ngs_cկʵuFzw:,ZXP̐# r<P]-gwiN&r^X,M .'fFhYst,7KVRvOT4x $.E}\G:-<9)muk{吇ĩ>~E5BCoeJ{;~3|cڰ %S H+]1C#aHiiTЀ}=,%LlS Z*"fd٠zOiA19b8Wg.Y#ʿ?16$ïxU3$iKp_Mܮ u)]C\!p-7^k5|574kl~ 7ӭeMݣo!s< .hTDiL. ,4ZSK[B(R=e'=~a =@ViyÜCWt-32WM\,\nX3wXj'e+IK߷p[:Ώv  `wM1'f>ӈpA^ ֋WZ%6p_DG="5qb'0'Wt(5ÀxR-! G ~p} k(ˆY׮߾dNx^&Ú(EwoIP׎r>-D 'lK "MK_'qBs(C 1}=x=ROnӺu>8F] X6%y$ƬU9@h)H-2t֙(*)?|7p *@#+6F[z)ءj ʾ)C< l@j+$zr#>!!rI"ltE^:RڍHp\d\.K9f^^˛gl]DS[y׺R'd&QHoQ=&hnW;$c@j*Ld$3_WZ3Jc]0`)'틾_D?K9p#<>zq_rv-)@حYA/q-s\)5rx `/jVq^/@eGy6- }MXbT kΒQ V `&C40n:Z{C!Ixna݁CZ[4{}PXY9|< 8[Pda㪐Mup̿BРҰjZ#qDm`T^^# 6{u2.nJiS4Rv0'ޘVC4rqGfd#9ޝ)PYpvZ6`"RԏQ^/q 㒂13E&{k;zc3  YvN5p;5p+ƧmP1"eںA'tƪ=RO:pz<ۭmb< =1bGIj*(K7VƎxW)lC ?1Bژ7jο!,Ҁ]Ơgp%\~=V`BWߍDwL;.|ҥ7vk3{ {x*heՂ7JOqn(({WrȚNp_zFTgC 2HI5ƞmoj_8y)FgR>rWь3Ů]P̛^^qYr Uޒ XCğzdn Vv3,a \0yWkbI5K0*@!$75!,nߧF[5Kg o.c(EoEѐz%$\CP! HuCSD*,)Y]" =}WJc Yxߌ !VoDݙdjcGL-Opi"'GV2i6uϼ{ %M12gwR!Cu囯-2QAI|xNj>!۟ohG} ɛqr R:S'2 Ǯwdҍs=e92*lpa):245\f#*k0xn/K  HxP[Rw3׫W|a6vOY0~7J?}=JO!Y Yhɨ?ز\m`CB2sRqߞn[9D'&WH ]*oĂRXRl݉ơ] .h(.#(*1Gpfybnm#3+[G$ݒުY|(M|ǟ^/pJ>)5MV;:5WD1}M:*H(IwC k/E{^5Og1+Ҫ4E!Grye=6 &,|?f^P./2H+EEQI_fZ 'b-]ķ1r׿; -N00H$_(ckmV;!Q0Cm{;ƣANAtE)G]1j{Q<;'CAdFa;@3ʻ~W #n)n>e(M> Af̳Ymv:X!{xFސ6u{/ (hyy6fU?(" sy(nŐSh\$ܜtmy%4DĽLď;=NV 2V >e~+?gmf;vBJe<ԦH'D8jzJ iB#ݒ=Ll ߈%FHaX-({c`gixo~5$k6YJ95omn?|0`< njEiT l@I@I;u3wP؄LFy {; )ΐJR-qH qU)FBȣs6CM,EcFמ=1lt'VЫDY߫seIw[Y*Ac4#.)Trdn@!F*h6ވ\A v7`@p&n2Xe2"5^zt }FU3re?OIPlN64!6J͈,-Ե~}% m]^Izqr_+̪?gRg^~`l;h3򞭆+EFZ)xÂ*k2 s[:@)]Tz/tEQ~ӮLy*9(O5dYyDiG۸kƂ첵 &>HJ)e{u(RK|m)e^rYG7$d$q|ȥXXER)9gNBO T`*Ѫ&}"UFH{V\GC)Z\-:1Y%~Z[(.yf{J,B%(\ zq;LɌP0 =/ԁx[K 5= 2[F$K]ݭEMVNS{7 6vA|i&%p eܣc c# / vfFhϛ.Z\w(jWv-E><ȡOI4[WvBG(?&k&0suFZGfЅϛ,$p^"YEm pRGg8TMyDSK[]5ONZ[kdE'T/=NHO 9n:mY` p&M S%#8_{vnOUt},f|C$ۋ| Eg.jSM3n>k+,6&(2rO_R^/>EKTA_N'sW+9"CX#a Q B R^fea$z\/y n@8g.7;lWʮ*Mb9{?#ț0>;Pc[_o,vPYj*._`GOEa:qP rJ@ uYKDCݞ7d}A=5Pv=N7dT坋`f5xLsErE%VFOIw(¨ @Mvs>tu;l˽`, 1VO5&:a5Pμ:ie=ӓGOr@9(.o_DccC=\*V2 W4PƁj-ے!9}NV&&;h;G(vF&乙GjQ3p`<f8;l'߹}D2! P>mEeO'7*d}ȁ n*`D_)_a6,d*U>ۂuCQ)kAYa_}3_m% /ϜrDkϒT7G*Pi>(pZ}҆ƒE{wYׁ.8 S ʻR[bO0qb`7nK CJVRV7˕xE)oQt/EG9;C,$=f+f\V:4N AD vcX EѷHfC$mNbF|.Kq+dg~!L@~LbjD a3}At$/SP6@6.vU}R@>]d˦.+ibfbo5$C) <-)iw}c*XA1K5שԻ(#߫J ~6bNr/WAL`e;x,qWG"T:4'[vtb],Ao`f`!Ji7Ke34zz:YEs->&x Wɵ?oB= ˆ@XJYNs:f5DĤ.{)O[>O\+\=)&N3aK`/Z[(aicN.^,2bCMA+lm!ȟO7 O3Hhp5lHu%#H#S+\e{md`ͤIts5je*@A:um ֙B83O}[@!Y |ֻ􏼹>Z9q`fTeTĔa nT4o#(bxݼA\.mN~'$őE6v\MaqvsPze,DBՔhؗ8A KP N0)˯r8N/n}rk5@a{l3M%)/>B׃!DӁdiKJ23+ Lñr@Vds'rK<Zrld4D%"^7X^Nj?P68n5Y0iى҄#h';:^{jjr/@|`X*zLw >Tk TJg[S'{c]aуis4&ؽr2ZB[M3QaZ.G2u 4F8$[*( acj.i*!LL2 'zPanbvG.\Mux[s HfЊUvn=uP:p ٣I%9nK=}ik+Q"* N-恟fꠙmL KaL)+N=>iӀ|39NyQeyW7w[q T!X5eU+MMpBX1ӴM뤥֋Yt=kxyM`r?cʵC02I$$Z C;ʵprSJ k~)kTO 2QDDSĸsZʮx@W\% G\PRqOsrwRo*Z1/|^J3#\4nUs jP tԏ,eTRU aPW3OP+ʕ1^JwJRt?D.g!zK J+6)f5Mq"_XCdL1>~ax>dSPyWW@Fopyyt'-e7iOe.;VO'"npO-)|eE5(@*)~ Z0Ԏ'ydLOQl5Xr'=}jSeLC#NuPy  Pΰ&Iԧ@uhq:6kO+M]M( k?3Q5(7 Iњ+!FK"i梢?Z75T =KTzmW刷õZ@*>EzDŽ?" ܖEN"APksZ10=={2`>D%[ 4bCM3 (!|2jWlZlMtm/`vJL)frܻ쳅K ~Йb e(93 wu!J<0wmkA{kDZe4G!pnsB?:3pQ"+Yڼos͑#s>- v=-\mWJI^aǖPD#$sXIÇwhl|U%`25}ٲ|c?aщ+KTzP=N_̼=F?' cr7J%CƨyV,#*!.]PdTiD1dJx2,J0n(a@f;p'(+4&ݑoz7W0-A+}EI$RH V;fD&=p(\~sI.8$S]xpsP/̋ >8ҦyȳE~PK:A{RGwdG7~I,Y9qrX~< "dX%ubW*VE9-Im6!N5RBy * 9…ֲ.xSBØ_;N SQ1ѯcZnE.J0˸fFV|(ApZ%7YSW#G_S,{ %P=0S2h1B[/G(N!̌J/j&1@~#$u,5,7\(Yv(\ւ^rFs2T= &.h>Q_/Lk' օqy;,m 3Jl?QJ7%,qRӂE.&D8DMYeəQ=2F\;_Pk+f n'GcwcE_` EZbåiFO ]xկ r#EA !-<ԗ:^vs +Ŵ\n7sߠ:$+@ V3yd3 [&|ےV#6@mFePXe%+<3fcވ2շ`B| M^ߤ6ԠHc^ ]1 ?b_:_)\ 4|d53Ի k#b[Z}_'g‹؎7I9 _IO+Io֬s&mQ6\@*@M5ӎ` yitE\ 2$nq >ѿ#g'fh)]H*Vۮ3tiP\7 *ʯ)i#R *ê!'i6rĆԟʇY- A`J)Ua$h[ZlChqęޏFO:R$d>LGR !s~11FݏP15]h5' xGf_|tpIG_XB|G}-3\mYG Vvv#jA: !:U籈 6N X8Wt^$3ȗGrk)w){*=.149ű?lD!i%\JCDΙ] c~T͒uut!ԟ8T9 ?( }7ѕ9ʤ{&_X&n(*=(zS#?g ["Vv[s!bfwi 3PQK gP$ <-LV? #)W j&t_4^8O6: :L>'6}#n!֞c7HN~<<uS)pht^߱jkdy[H#b9iuUF,~0U!գ3t)NJ(Pp+ƣ/r6&|] Xխ\W#$3jzO, n/%_=5Lmf]ZT=p2ɥd_H qh#i]aj@Lܴ;qLM ~>[n7J;/Y˧B:NV5l}iu-B~d .~ R|=t2| `%9=I|!P#@[8^LfIT"bϓQqJGˡ B 6UJ 4-Zr|}oڿL}\ 9NHI#f|[M^ӯL]G򕔢@adK=[j0'y Z[Q z7Gp zZ۷qBbB!"X3D`!q/*͵O*pQ@~{T^l'l>Kl*c.CYdFZ3AH^)~,}k5) vPZ=&P:=L?`'T-Q/ѥc7)QTiӁ4W5~Iifr,rp#dWܙaؽm\¿HbwlED\%5Ăb)s2naB-Cw1l-$TB#;fT&H\ ":)Vj~Nwajw7wR#MI M> ᠝S,\6E}M7"i8M_[/>~$yNX|աK:8PD1Χ"L1[|jro&K>랷*zؓ;4 5Ȑҽ-rjvLJ,/lIdFɎp0/_ :h;c:FlfSޒȂHג莤=QuBw^HG 9t.Dܩ|.Mzg.ЭUd ZGi ,\Z؍ JdR@pO{=Ch8_h-S+a bObG=c?Omjc?!r6Ge`{K_^wOIaH>czʣOp_ Xh3Wy0TR۟o)%.Fv38^4/6/|*ڸhEA#1t}L!<Ѳ&Ri誚zs*L?L`Z*4M wESBͲzz&wHk׵}]8lURq](FT):Zx=1z,(Vʬosq'U &RG`@<,FV-J 81"\⹪/,ZS1Q(,'UA81W4KYsnO .a] EAgS>؜Ⱥ(KNjh^z?tvVEg17H*zijWRNGjd g䊐5UBˍ6":Mes+َk#T#\[_:#BЕ()H*5n,/ 7Ծ]|Ӧ`gO=XS`RM ~}1-L}'xq͎ W@.ݠE*N5^NAm^DDG3O}*pfZj):z&ER[ ϩ ê^8O=hqP8c8V)A0@dW.J S.0t$>WYwCbGo)t I,Z4cghE5%=E\[ *ChcLx>n)0Җ(Hc.˳G/-YJ=T" |/:jvz/ R9M$_xoO!"P܇5 `X }l 4 4(=L6Oi^2o*om/"~xXcibu/yL |5R%~%v"fM6F - j9k[Je֩v%Vf>~=Zn9~O3J=ו(?[w,Z $z˗+Pf?Tbv%VʌǮuRkZD85 ?,ibn]a}RKN<< %s37y\Y;~&Hφrc4ymSsj0:+a2SgrRF.6A靥\C{ؔ5'Wޠ8<[OLJi %r-7fXz{MԎL <̞ՏHǪV(Ӈ b- {UV,ؙ4±$k9[VۢV\;ZkAW Ji4uÃr]R`j{qzm\) D.H&No=yǻu:z}d(ޜuQM(hV(I(U 娚0.cEHVtCSq)m*G0:gd Ȱ1=1>NXyWD\21A5 'H,GnN5;߇|4%*ڞCts׌(9ELhGwxɐ @`Ѡl œI<%:f$i|Ss(dy2~EC: F"蓶PUt+Pŕ&Xe7@WڎQH(aJC7@0,߃_/tǘmI/.J Mc֩$:@#ܢj.*!$X#ή-!)8 Z vݗ\jE"6`nYsi%.K+Agt G_+=N $J)3m9f+'|ͼ0tGĊo Vt)M(Vb7(*JA3'>0M;|jyd (C#Ddw;e_ϡ!8yͧb@A^"#6%7:cbլMW%7 S 'OæZf?)Y~|Vx1\ opKs %.ɞUNCT><֥5P9PnTRYvc7; `eԃ<0==Fr}__kT?Vsn̶(~,Ms- cՂdw "ʹ>$ssmInef7هɔs'5kd,MKls~U?)Qe9 7cfhJbTb!sFOՖ-Ms6csrJгrP/P'' UzA4J( Aժz}K7Dr8 /_Ӝ)i5'a[$aK.R^>%J]bɆ?0ޭ śkJjTL&bb dP~u}v{&Q vewzA҇T*btE`r,܁w;ΓZTH&; r'h',ze*ΤS%X@Y^{kęUb?g+ͅq& \' B `P>lA NVr*)27qg6~zcrescDz=%c<PؕXQ(mM<V֒7 U&џ"^(@O?XN3*,kYit{_ad+N*)IM,[G+C ~eHw {̏|)+84Iũ| {`=Jۦx2V@S4M7}$->&e:LRCgz)o˲΃t *'XTl!0&}eK~!rV5*gbǾqˀ>MKt* 3›Rp}40~0_Vd9J}KLsRůHAv`P)Gf2zq|TdnLW| Njy%t8}ĚsYUƄ=2~X# T˅SaH U[ou؀p̍Z<8,Yyɶ]vv/b,c@qHJjW|Z Sm"vlqAǀ"^'kpA=}0!oGN\Gv:G2,PwO}QOWX>w=]>FJ~b0Ӓr{#kr< Ϣ蟅gƒI2=˛Ѣ  LB-G<;s;5 ˦˨Gxo P:<Uh?xFM(rzr :@fExHch?$4{f.,MW`XwQݾS >^[_S'ZO/ݪurO#?+̃0BuGꬫ1Nsg@^^vInA\ ;.o]h}Ia uMU-&e>35;Ľةs0;e~F$tЂEhf7N>,Ƒi0U1p•# ȃhU~ro:2hуRI,j |6"1Oi;m'~:G%iNint4Q@H;b++UҺ bHi)&Zjw*C ezHe<3E6*{Qk ow7t&g(Ѽ*t+ˮNMP8"o\¡ }C~pQ$0]^zJY5^EDڎ0 8_} ~#ERE̐Q`aE1k㹵‹@|FYa+u2Jw wG.$4SvyEk1yI@Pֲr ud"UNq1<(C!Z7ؒ j z7AJ7fmJ;E7|2+8X/> Uϱq07_gAT |ASgiw0`Z}0f_4374X Pt٨_ kdYt]yzP9 B@yea~ƓMQtRhqϔw6FS\EL&Էi)9v}_p3! IgRtA ^Lu%]ծCSbT$S[5U2?Br=OAk=LJ{S gf0{'-–iхVBb̎Zk,ߥ}h"H .il"gL\s?%pI_h6 X5*j-J<+hB,]ρ"v6?S!1mbB{Ŏ.$'j'TU+ֳ9[x "\Tܡ,IMv>&f|} 9 nKfCzRk|r ((jW7֐챠L4pݘx4|&Mܜwj/%QaSQd|${bC H2vj{_ŀ^, o4yK:epa$4Lϻ`(Ylruoݛ7r.;n߹U8AY  +mR]pQqL(p"iRt2vsV0gsr둫&#-m팡 1ft4$q)=4,D0TvKxMCxȵ{lϗcC <̈́^}laR/ Em~ 1xl/ c߈NgFLJ`ͱ(` =tˌB Z#L+? 4#KScw? l##t3Ipd'rm?Jqqf]i|p1ECag LPg]PW*Fֆq!Ot)8B+ͼD+PUʼndZ9C?.]+i8fO]06r4zL’vPg`V?#h}Idk#1ʫ_ZCH3Q66݇*ݖF7 5aHlua?Iߘ[N^YblLLLnxu²{*| oP\-`ԟ.g.Y&}w=`,.x$@bOP \T?#Y]EVS1@N=,VgsXyPcDt,i1BFFrJAypAcۚ1dK^ۧeH-$kB N\bǕ6v%|GWrN܌SÆ_6Bۆ%Jo=J#ULP3qhx=i仮0eH.p 'SԪΆ9 XY.oVe `lHԾCh36B-,/C-l?!4w=ssY_BLKd'R+_^Z+@+ I]I&6خ}b ݘ#W ,:n| Y; u'(5ONCJƆlewrR6% A@6Bn&ɂڅX⭦s4[ˏ謬#lڼCI=/Y<PHw59^sьE#~T"h=3@9Lɚ^ LƒW_;@nj;&@1u.#LǯjAB|4 !rE^&\ `1YRԉ\DQ֭0XFA 3Z&yXe~W{bv{E/ֱ6HvĎ`Ƿă'*i!~v|89_lB*L[F5-B Gr捁%ΰXVSJy}:-Cle>Rʹ3!n5-)w]*qOlb.^7ut DDw\WEk(P# W^Sga"&;>y􀼓 (Km̴h~}j$%ۍ*'HB S`awY ֐)g2%TH 5A$+F8߶ Vn`Sl6,P]+:Pdxϱ)|9B`u6o)r=3_sQ%x:z߱jzEaǐ+Zdh:=jWp!`pO<:7u'N,qw޻&04ƭyZgS|Ͱ!fi~Eb@@|K0%wb T|Rhy2)"juAŖ$+kR|f[u#u>"@J>D#2ǛyfvB`Ob8}=Wy *(ԑs)A>y%*[+wJC~-}l>o m"4!^ԑDŽÃڒv"Uy' ˻:dB*:SIq3AA2bL=][V (F% 4"{),9#g[^ &t5jEjV5s#VNPڠk^Bnl}lmU_qO99LW\0 T>e"'uS}-u! =!e[iGQCrA>IUc)\DV@'-rR݊ Aby022 3|k20B!I Ԁv_H8쭖ۄo_uA9@}< ɘ#PO/QRQȟViwق>ʽYߢG.Tw&g 9W\S·{}i%g3xzb$14.k.s1(^0,k57 Y ~qʗxt]r ¾  tMZpkTѡ'4 ko W'8lꜝ+uU Mܰ.vrLQTO@^u]PQ܇!k>7i1Ƶx}qQ;ŏ*8 z8bT}P\ ګ+9[ˉ @ԯnm6j-~ 0( 6ݭbЪ]yv'eYԕ-ԑdISSӽ0Pv/p /e4w.ɏ/\[\ ;.v6E4\~s!䞠?3muA1p]% bDʊ3>קƷP> xz$}:MvA!xo941uj8ECL]1zg.XeUV#CX_uyjc]joQp|B485j5_st x2NmN5=ֶ85CB\f x7]F \›.*gBU53av{V$N࢈nCF-Ue=F5&vuj ρxZ{g:uy"-5x©Fn`4j -K?\IlښNzcwqMѲ"µ\VWW΁pRCct(Mɞ?NGG盻h֠QLH ?*\;cT UYkIm4uT}ME ѳ[(~^J1L59y{=+fz#N)io@~b=]-vB=ZPzY)D&r/SݱIX42?`Glc~)ϪGVqKaZ#"VֵZ Fq}&|*} }4Hv,Y~I>?j=#I[hc/ʽةpp#4 #sBLȩܱ3GF9i/|gNQәOa2MPpdq̢ݒg 0f CX`EE ){zs6v!l"Ajj5s]4ʟV-8i:83 g.uʬ`^Щ *C HLgEt羣j0*xUXܦᲙDž'Xb!/'WM~,zNRJmq5;ª<ұѫԄ>g zx|8|ֆx'er$rRv隗` #m"h, j=-NE?qeuyZ [,#*t4T~ V (RL6c"J>a_md0&ti . Jvo =[,`2\w&JAvt\+NǵlkII+qȰIR+7e`_ϼj!n>ƴ!m[;COka@ xd^œ쌡bݰh41<"M "K Ho0Id}u9lBi:úx!}jAp>%ONPZ_~Uk{LbhX) 3rۛsԄ-.q%8$4U֐Ct"K]-G6X8x6cg6ռGo킦-za0UԋQNog{ dchuVu"x4Z/rOyoFB cX iiXos)%A!!HT.uzkѫ,p` tU-=^yyITsȶGx<6IaMAрvkl*G%/25p0T\`.CB߾Ioz?1 o}Uat|a^_@i{R"$Ř)#a3z?mXQc.Y"ܯܬiu<@Dj"JPIqEm#1oQZVހ 2 Q0en1xU@q"IbkQNwʦd1ax&;*Mnod!ȝݽM&Ira^TTZ#`_AΪ8zAN ziSI~̾ũ!Ky$FIW/A!v*mF |O&]p ^~{5Jx5|qo({1lM^!{ƕ3iVfm5eo$= 36#y1 ,Ϭ(%phZ[Lpɲh Vj? Яu" O (A?lKnfhy+1{Xiɧ}"։iL~>qf#k0O`@M6n5aE[ H+Z\_}s?CrFVA+b tm#IM/|`GT/&5ˡI;o 뷟/FL2?l%%cQ媭,XFS IT)GΏvGrjm1HaIWPad]# A?O^_*KXw3iVrhˆ) J0w&DͶVp88SGu. 5&U"bLyrlЪ |wz23/ÉErlV {nNb[rBjW%st`_8'~HFz(R^ϯHZj,?~3WJ }Г:Zx`歙3Bk1o!ldTZʇ؍}vvq ܹD1n ` s)p2iq*B.T/H4Y%v8L VPac^NIb|=qm{ ."qgGCF3-(gRXyQ~p]tzbp%rk3FNwJ_vLΧtdN| Ʀyo,#cx@yēЯY[ķ}t,Y@mKb<;l=sļ!nf d?+@;Mo8ND ޺DGr{C.:ɇ .'jyw boe^wzOK"S(ʱxYe%> @k_w'$mQsr0"!ǐZ2+9-K.b_/uF-K^mUTnޒ^)o ]~lJg^amS|Y6iW v@X#gA{ޖB֤g 5ujӥLB^̨z%4W% ,Ů|.~/-b0@\qKۈ[bxQ%l (RҰc7% DrC\.!G2@ֿ$Y?#C:+5_1#꼯O4̉ ,UwX)bg[J,o1Br~''#?Y >ϋr* c{hU'8O[Li=ይÍ Ьv!XaqY'|&ʦcZRsg?6jrgi̭gUvW)ǭ,)$ hCgĻUlZ,0tY4QKv%&f'Z-ʙss^7rZQtͤ_I*@͝8a6V,1A4ʭgF*횾ɆhO2IcBDMY^%df-$B;p|e`=}Mp𺗧m|Sa(Mux=Vw"H*3/-)&Z۠jc. )sAa%tohIyo|V}IgO3 ,8,/Gx|H]ON L:F}j5Uz\8A\ \/3b_'XmѰp:BE|"²I,Lm7f,Els ivᒘ\U0rV{8,+&bSPaZ=ad>?m3 hb fFEfMم'05~olL ͦd||t,eCe%GԷ!loEĶ/եݭBF93GMٳ e:N? 3B$Ȅy{2(}W6jI > LZ&\'Yq=a {W`ya0sYL/㟨췿]ݢAqѥ_S@[bK.F`j}ͺk/'qBk׷P6@!DQL"ї5,ln|Dna{'梁2#+'l%6ige}' i jSPO4hf|P;4nϢKb =.TX2 aX7JP *߱lONƂ!:G_hδgxVPIJh7lVy'X 3.e㾏#Sԧ|qUYF`9}WA&UjxM5V$q$< yǬ9Kfh#˭WpHxECyhB.lo 1F>sAz+$t=Z6GU[Ő%k5#w/)J(tM6ʸs ?.o lț۴IӕLg=_ܾ\WW]mPPYGm*t=r!PBQ*vѶh7џ Zˁ}(q.don1jKq[`l3kWf."xEсAݣG)8}ְIVx4:/C iՐ6r AhMB_VQ<, 9|ĤMu5!mIOV=鴦4!>)[;|r Ul}*#UWv MfٰOElhHQmx*"F4uk"VMo.ncr( @i5&,d 2,$V"TN\Č@(pUv% E=b@[0K%e|Vx[l~.wXzL#/Ƿ7~ݜW\K/zx\7DW4d_ځ잭R;Il{ۆ0QFB_H2WЩ#MW'ߡHc(erqpa;6.r|:r6m7 > 3DGX fU\ vILNLHGF;.G)D5ЉwW'2+\CPd}aB1vSPe`OvuVڡTiQfpZuѰUUݶʆ?4_0ԕT$&1I\Q8'ݳ7`nL1f4T;><.8#%w>:~ +>\?itzG5 _W]/d TKUA @=!aΌOǧ{$]4S$X[{s+ޞ~`2(TX\r0FlNu?. 4 f՝sN~|#퓌D`b{C ax,"-/0abˠ;GNNP=J /UHB*i]Lg16`[9}yHЁnMY~4CZ~d 'ǯS{kך"zC2!JVrk-b3Nn+d >鐲nfka-A8Dzz'dIUr'iO~^4[ |ûWz|Em;KZzDDwb뮠w~)NMNC1c Tj"ޘyۖF?8㾒O< TgB)m^A=,LD={L,runN`p Caco=sfSZ_%w$⌑8{9a^ؓ۸;ٷ u@Z[ `EwSY v r!#Z MqղlKGvy:?D37Mv0vI'oyj$})dU,],8Uzq7Dn殬䴹Lj@FYNc._8mʱ 8]պbQ?+_1Q?F! KPux8[,2%~u#(kx{n<`l"w4GaѽwtYƄݽۃ/1~j{8ʁECr.RQSOX3|ޫ\dJ7cD|(G)Q(؇þNq9/R|1 @xf8pwEӎUkH4޿y#oذP1; Gbag DXe]PV>+lטּ( "~%<\fS :0t!z' %OrRU =oZiF[Kwx_\ե! ԥAW6O`/_vxBW}dC>TA0CPmG6vR +VSVdRǐ-]cJqO $n˦?^xH]IldK$xlL]8؁q:"w~X*ʘHm 8Lĸ@oew HլJ\{ZHIi6|Ub gs5X[|1BD^>Tf++qجٺ+o+__\4OaX>ǻ',ظV)Y>.([Z?.#S:r"7É*8ܡGKfT+11 쭰h7XGA߉v :t̓}ig}&vӍ=2+cGaEőEb]{~w"Q.U-`XD ^<ܜe$x .sY1}o,!mV~$騲B:A~#b68:/<@=uϒ sShd/7(dzADM 1`~0iRuU:L :2 KOD_xAEܬzaL *^h꿓3.9j-=xِLf`q51݌ ۪ɚ.Ds?#pL,4 SB٘ ]rD{5CW>2# 70U8BKFZ;eZo(lY9,-O˰7A1O-$\ /H);g1{Ge + DYa9eaUPdX?Lk,Gj\mߦFW+T3mC 7AҪ'{G|2RE HP (Na V+ ϝw cvj!XmJlQx~Uo SÎ)Cf醂堲h6=it ΅ =ïp&uɮa걚Idڷt%Jh 7^wtL%cs5p=Qy R,!sƩ_f~xbUKWOBA%+Q+b!ԟf.FwOPik/ITn-n&}eC1Z|h:zkb(q PCg` ۇ􆊸s!,WVgO3U2 'B)X 6REq`g$]s4]zbA+}RQ+{=E{P(ף wx Wj>c๭QpJycI#c~[WbG wť ruj٣ WUiT4˯K SׅW#id6Q4Ų׌T-7 9'%Ǽh$Dj6B@1lm$nsJנ ;?[,jLhwV~ j&Atkm+;w] A5me[]" [3Q3SxAܳN@M%B`ҍZ 6:#9H]c{)R2z+%}8SqcߙQڤ"xί\tD*iߦ4nU| .JKh.2"IՐ/.]DQݯ]הV:CEJ dTZaܝ 64j{T]ZmRķA lfSt_x=ͷdl02o|p(IQtAjޖO,=GM C qM]47``@)aUw̓DVg6聂t.B?~91 W&Sl-^-! UBW*TIY=cpC qXu)y1)8~9fX֕ c.Gm2+hsʂ7[[4'yGO&^oGe ]lJa ZR| Q/F]_TcQk'V^ܩw@Dm 2D)¯C',"92zA&TB*u̶]gmT _$˨묱侌F/+ 58p&')LB(T 8|?0sd ԓ]jey@Km7K ZgҰWB Vi%E9F3+FdoVН=EtƖ0TI L'_h0<aC3ZHM hSd•d:n 8]tK!x(YL6WV]_r2M۲SoW"AehM)M#-^ϒ=6*f6&2\e o(Z锓Ցw< -9Gm<Z_\r0/˅?KXQ׆=595dx%nJtY݋'D+$(1LE˶YTLWrJIJhz="c}]Ra(֜v0Yw%3VZjR7J= t+G~FKIՐ"鷿^)JU>詫Aim'i[QcɪYڭ'*1uTQ-9r1?s1Ҋ:Z?pSzMdg#K?-%?g֨] ;>_ .X/VTGg HDAzVcXh-aE{Æ/2`4 Ȏ$V_2~o`G|~6wrS~jW|%C}Ll T y jSƪ)Fʆ! [)Zr[vG/t꫸puxAd=iC7<^K 6B )JTtV_,C9q&0 ]N r_emsF~16(u-zxAmE"xg,9įu߅ޢd\8B?F{;Zn(jJ+La/Ԃ {oc@vհ'G*Mt`U0L6xɔ1gX#MJfw)zM:G5+\er; ϜP^IGWAv`d りۑ歹&r2{%<.']f1 O`y ZG}y~r IyIřX":, 9g-to ζ1mDm|>A/$|2B:wn qi6&^dC C/\\=jǮ-X@Rb |_4ܒȉjT7`( ۏURFiKG^q{`4V*mW0Ou>zJ.>)f$5|16gÜ#{c1R48Lm(1, ϐB*' Kn #$F1~+Q FV<#"` 7T59&>"{>Ԃջfp1s,AU)C'XXjƼ"۹gmRv |ۨtcilj8ҶpwC&hW:T&KMs^+UfXx&/up br^!A+r qELG'^zqc`7Þ mP6)/*MZ7wLf (] .K?輚UFXMzS>kzN9܂؊ QYyaxпY9zY帿QD7h eɅRF@%Kz Z7X񲩟jڐG"uToA[:n<"@$Mi!Ϲ1A%p# %%Hz2=QLa'hI3oĤi؝d-;|(%Y|Sm&.WmLjY v\n4rvlmxU)>P7[㽖àmzOfy+k27 sE~A@$R1\}v.A)qbE˜s3ٻuCG£ M!%!7ҿ%`iM.FzKW2݁|mmSwT9H>c鲄8϶ 8{e\Gy2d)'KX}B0WZ1ڿSt1huVyX`A g?(Or"_[ХNYC*!r.L)LT">#َFZf/Eb'^ ?Q[6޹dsʖe{Pghl$ ׿h<=hKxTQC$vL9Km` ƽ]?^壎\O J ,"1OVuEǮ#dOCAk!4|5w V|Nr Sk|.M#g+ߕIIG7GGT:o"d>ȅ)myU*;# 5zFC.is^ ᮢq7 j2O.>!,~36ܪu&_( SWtdmɏ拵b Ħa #=˨ W(ˋ.e%(-1+[c߼&?fx&ȡS ^qF U3]%^)_\ z᥻>0 d^).1P8{5|2#⾒_ >bhʪH_x2zҊ#nr ɕ/t|z`LzGV|m6}w3 Q01l*J9h;A 843pjؐ(wqO 91Wxkg|ψG ӒiFoYC$ = +t|m]By$qQ%[*ݧAe<!ځ[ningSa\8T)ѮGW3di^&!{Xlu(;/6#y ٩kZmfv dzȕSXםzޝI#%nԟN9f֝\8 ;ҥArW|{s묆hfU664h.y.)/bG B}r_ֻOv8A锚0q2Xrq, #V6r[lS&jH>ߋH (i%"gj&#(.W\Бc*8ua\Kф'8'Ě.^:U ToخD&pAe%6ƴ$jܹL upL;gjRT#`]D!({eut4ϭVy+'X gd̨rA!#.'*'Ї,M]1j?$(#q FJV2U :gu޼-J[71J"?Mxz,@06v׊'ݧ8LLmҺ#E6?L0U<ك5UurVEOψB]"ִ:DwC,v{৹;օڲ]LJα²>״6n#j0IJt(3#5$唸) GanJ;eGmI;t,b,#2%;Ku$xuץ3I7x*4;t^)տaP dwvLXe\&tR C < Hj]ҙԃzi sMNh:d7rX}T(}֠?c$*GOxEܲ*";73]mIŹa5$w H uæ9uGiϨZsXuÔƒV'MF ;ou4TȊ>:zR쌇v`/ 1sj*a˚4޺TIץ.5SpddrJ u!eXϺo}`03Y;rF4W<brY{6TZFR8 MG}o6Yz?d܌4 {;p,cJVy<Q7D7nk]:}lcTPHwtZ,^Y} it2ngɺ =m4,ݣ.X䇍aa4~J89X~T⛂wQ'P}Ha*{Ǝ~\J {&@ǺK5> b3 w h<h#3Ҁ*NL! ҅ `wtß4g6nŹvHEl hJ,蹧rJ@.k^av_WoBpL6W$Ot+Ͳ*fz9,@T6yAΠsP& !kNaYjD3(N=>_:ъV^4X@ՋwE 'c" T+XŽ 1Qڝ,8Vە7/)ԓɕ˂A IK BԒ7=Nz{[Q툲-͗0HЄ;tkcB6{PEKZbg/ h L!HW}+s94}@i #Dwf͗j{u_X"`$osS9E@ !fh@FS*9ee5cuݫ:<&M:6ܲ%#TwjsXtti=ܗidQo` -[1\=;Y31S:_m՗/iX",}!0aQZ.*(دr d6WSTG>JQDjD_w}4X(`jF/} \,sZ%Yv{3 f;ۥS#qiЖni 'tFEw{(4?fnCkI7ףecXlFT}_ @$#jQm gy/;ĸS<EGoUƂfB!nuBehw ]m鐺†.mcQaZ*!I-9">UTe="-t"Ԛ'ɮErMWH6 V8 C> ^{D n +c\]qa)F1|b=[*. (bjHո+μ%fA%ɨmQïR |q& 3f먕_+&5׀o|8B#MhL0Ѷr"| W qaF>eS@Wsj`U-gdD2Ҝ#Ȥ #gmXa{4sz e(+i;zt{w3+=zh`nֲ~y|^?]b ?@Z{ΙXh@ΔLH-HYrY50!v`&ck2B-rRuX뾀~Np*[wB{+2?VRjyӶPcw/A2½nWײjLA[nVA@R@kvֺԕ"$obP՜qUE`5~Hvkc$ +D,f No hPG*_I0Ll+Dw(dU@̎T%Y!4̷tiX`C)ԫi9뤃lIk)GU' ؾ v|J8C $bw68"$; (yu3 *c`7;ޢIwoU4dvEWqʱz$w+8t6k#93~ˈ8s M2o(𶬀ՀOl?ؾ>4H#44XFpBQ>>~3NSFcwbG 9 ?ioG9^81vo; VFNu, a.D OsZXTWNՔվ?QbL#*0"Iڀ@^9%[5pb,^ *n&GKcUT. jNPTKLi~͹(F4ҵk5`%5/H'TŸz͡uQX-'7 5A'[J'*~ ?h)7xtImlZz{^NZc&#}Rb/+HmiIU]0•4BnѝxE&´QtD<)T1ǥ1*,RMLdkvUݑW8ZFD5%x#09kۋ!'cx[O 7rczygh}m[Fc׎ K!=л_ g,q?[mW:FvjXD{s]y*~C>\Ϛjƍk9aٳ3" Be2FJpM6=6Vi<7Mt` x}6k u{ILbi/՞f8W%xk`\5@,ˢClɹ_VfV?} btFbB{ &ܺUs>n1x!/{`rZA-I{ϙ",cl̸&Ѝg ֢3ƘI ٳv5)]Ip*q+ls+{PH _گ5 r~!oN~p7v#!Yr:|;ui7.'?4ɥܩ'6+4K*>~B= xRS4cx`caGk,:T#$V~=$ o:$A ʱ2NlOiM~D ~wSh9j2H;Ί+lG`Cyof(N=~-ghDN ~[]:qtMOEqpY VNOZ_fZ0)RrgqW܍F, $7 Ժ7f˷V/zccz &)gԥ.=>2G"n tu2AZQC;񦗤K^?MQkTԢ7 [氎9Kc] 3\Ϲc5W.+o*nt]Edk1ĂW; $Ii8lKi.goǢj5c,}笈_ h;⊗*ɕsS!`|w"Z%>:G= J"xݢ0GE Wׁb'4X锎 xlRwlӕKvЃV7T%PŗC2X?ւ&OSۂTQ"057t\jZbxv@9(K>ǀiwqoD'p3$eXZф'TUX?3g߁W[ *YgN pttB :wtF* J3}54[15=* vI?^`DC`6KTu(dj]7/NV=8pv[uyv![ee$-IpQ?el`m AdJq(@:UTn}?+^Ỵl) aKy +u6vWuL&Km.N=S)$ _P** 2Jq.tψ;Ȩ֩qS@ʕ6Sy>Rxq{Qs\Y > P@a SX_M@wz7FL(B` JiT][(NLF:X Fb7QQNC`Z%l _\c DT}IaQU`H8hKYicq#X8cߴpEKPl")Jڞ(.>e*/2XKm³ .c$G$aSrI?~gގxw#s]j,zFڀw(0kA!(69E2Gf[)\5?" lwcaĴ馌9^Q-՜bac%(G]p?m@\;wG{ӨXaN};.? '&+-CFcƴ \=J>ߙFHڛ/X=o |re3@csQ Qti Pyשԕ9p-;j[|(l87Gw)o;ȩ#K'qOT F{ɿ! ? 7DKGN)}XH)>/iZ_!h Ab/{_>"/& # r3CnmL6~ec _C,T*4R|,MbBH~\5њP- $hnL@*&y]Ui*&1Et .=:ГCr^j7O^كŵQylbgC0+\L+948g5lc1:ک4T[x=봛le UQkiV;[트q߾ܛ;<L_VQKCh+ ?Z<+PT[} X,L k˂VA69zsyP \w3~ڞN5zt5_ak'l2pd$[LSl]KET 㯕u|` )6~m4S9]*^?%*!TBf$`Oe44n|+qw_݈U?Iuj;=ۖiOw; @ʛ yr '8KGm2>{fP1N# MyPmR99:ϭA*t ~cq5s+ BO7Re^u]&NSS#q8Ӽýv˷]X CK7-niWU$b(q[{V 0ى@,~EyLbH Q*Θr7yI`SɚSw~:qwNyӾek`I?ՃM)w|Ia6-$fȶEKcBqzb߄Bs9# eXSlA׬!GB~]S}b䌠1һݙp%%9/o^PHƚ ^nUIU9v Tp:I-D7KUT4g"6F|92u74//n=f*Pn!=6&[8S?/YJs6T9Ql\MQtZ/PvA[zIp"Gv$+a:θ'hQ4:z7^wt0} @'=?/?rO oBgwp {ddchV0r5".g8t6&@Y5(C> B/*7Q>%t+FF%tV# uCY]g !J*ȬP8%xim,9x5y BϫXck.sZތ[%pMY߄sGɻ |*sgqǿH#:qE֫!={xx@w;p FYD@8/Ye')a ԉH+`# a;1Do!G)xͳ%xr+[sDlڪ\wqLȰBz5X1U8PogxL9 F]jJuf o!,1GE[womV,T욌XAvi}=D!܌*•ۺԻ|5Wd(!ps pd6 /^VCx,[M%g.6f͏?@h]{[xgdӚu.W}Cܾ4AZt0NbGqga{7h%!cerM (25 )l \8vNEyRՐ(EO~˘r.=wZǟ$6D: ZV+ԜɁx5eTNJpGL?5z]D,4!Wlۏ|?" =B n.PiYC14SGhUg i*_ _{J>{UcސFNvyruArVeOjDヾ#J4|dxY'h#^ md%BMMT΄vLk Ɂp>uvғ/5g .W3Ulqdy30!e2[%6^G%2tuύW$,+W/{zT1uʯ} ι1HuEU7DGlHPRW@<t`r(?8Z쏗$7GVI,RKDI7 7a D!s9z\>7Z$M@ }cO7=5P=ٹEg_զ;ü%W SGxF &o/zgEv<ɱ9)!Rr瘬G#&JO93D_K}g :c@AFDwTbM6E`M$xO?}Ut{֌b"oڑ; )yT6w;4i8Q'NFFP&߮Z#@Um +{ {iqOdxlGHVU1|wӨ q|Q!agg1hXLZulq}* "{K?/^9e?pA6۪V:s+ݭ \z)uִ4Eӥܠ |צi_=5^g)IP_JFXw_Рժ188* \y1E†^PB0V6?A$dO&׈cyZ'V&ΣxFueRd 2I:%i obcـ>B?htT B͸%Eku-% 3?AZKGzRZǐ:ކߺ )ahOX֊J4zeTr(w&dF awQ|_2za4&JDROܹ?t?\h)Iѷv+^R}_RvD!ѫ#~|,oGX&y&:ϕc7입d3Kkڌ`t"Pַ~k5*Df&luHh/sLu]c`-*y"jR:u~aw 37SwEξpN~.Ph dt&4R%W^5>:tWrZI@jā|,V@yw5Ibqߥ\:nbᢢX͜BI46FIV]c번[ {CI wT4^58^,eRr@%/ބ#`ʕ2jMײ58A* a" g# DhI8vPvL5/Ӛs0e:Hbͭۖ&} kDyWT㻲;>(0MS0_/aCNۘ5|wL~;t"k#ʹ~=g&ڶISj4@?$+Z8+v]a,>9?̕HAnպSƈwq㙹]cBR&1*t_poX-.g+)UkUUQ"fg:c"|TvhC_JSKV)Ssje ^̛;,yzs0kktU퀋2Qroǟ__:fH/ZiR/6*(Ne\Z oPl m%А0D܅bD3;fĊᵮ,q8Ur 6bp=`{8%*KcɟGjG-9)Vn_zzZN& }@WԄS> )Sh#Wx:)N@y)X IuKL}rFʒs36@N{{烻U JtëٰjNqH8;r 2 BsލŖyB[G(GI5m =o6G522X50dc7ŏ=G\LZmtQT4G]ߝ&R~Kyjza>5$"pM>Aخ:lE+ND4`[e9Y)GfY_ ==2]%ʬ& gUN&0td&M|tUv9ޣzkKC$Fg /kz< @ޗBv}~Mvx6KTR%f6ʼ a\㋍l䇱g'$nGCG'`}ɯyVNC%aZ2O{6U?uqOlӠ[= nB5C.bhnlf2Fm ܡl8myvsy1<8ƘWL<:$4SxU!~a q+㋑*Z`xZ%2qQ8!=ž Kri;rnYo,H_;mowyFkrx6骄s]M}L6SBdJZ] T0ˆ1wHE:uT#72;Dzf/yѩ:0"Cݲ2,;Ui?˂N=|'>[0; ߁@ xmSZc Jnci 3mF'm҉H,q)>$?`or#0[ʵ*Et 2%(Byڳyr~r;g>|bK ZcFtbuG7c &=辵yП,(y͋G]k*~1bS/Ѧx TdhgŮ*A EUia_"/ez ~ A+$(M4 Gچ1èENўALEP6X6N,-Ks LmgmXs^}ː(;Afθ7GZnA*R